PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID mrna09311.1-v1.0-hybrid
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Rosoideae; Potentilleae; Fragariinae; Fragaria
Family MYB
Protein Properties Length: 278aa    MW: 32512.2 Da    PI: 8.8802
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
mrna09311.1-v1.0-hybridgenomeGDRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding56.65.9e-18651147
                             TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
          Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47
                             rg W + Ede+l ++v+++G+++W++Ia++++ gR++k+c++rw++ 
  mrna09311.1-v1.0-hybrid  6 RGHWRPAEDEKLRELVERYGPHNWNAIAEKLQ-GRSGKSCRLRWFNQ 51
                             899*****************************.***********996 PP

2Myb_DNA-binding54.23.2e-1758101146
                              TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
          Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                              r+++++eE+e+l+  ++ +G++ W+ Iar ++ gRt++ +k++w+ 
  mrna09311.1-v1.0-hybrid  58 RNPFSEEEEERLLASHRIHGNR-WAVIARLFP-GRTDNAVKNHWHV 101
                              789*******************.*********.***********96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129424.789156IPR017930Myb domain
SuperFamilySSF466891.98E-29499IPR009057Homeodomain-like
SMARTSM007172.9E-15554IPR001005SANT/Myb domain
PfamPF002491.1E-17651IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.606.6E-27759IPR009057Homeodomain-like
CDDcd001671.36E-13950No hitNo description
SMARTSM007172.7E-1557105IPR001005SANT/Myb domain
PROSITE profilePS5129418.3957107IPR017930Myb domain
PfamPF002493.0E-1458100IPR001005SANT/Myb domain
CDDcd001673.70E-1160100No hitNo description
Gene3DG3DSA:1.10.10.602.8E-2060105IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009737Biological Processresponse to abscisic acid
GO:2000652Biological Processregulation of secondary cell wall biogenesis
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 278 aa     Download sequence    Send to blast
MCNSTRGHWR PAEDEKLREL VERYGPHNWN AIAEKLQGRS GKSCRLRWFN QLDPRINRNP  60
FSEEEEERLL ASHRIHGNRW AVIARLFPGR TDNAVKNHWH VIMARRGRER SRLHHHLHAK  120
RMNRTTTNAT PPHQVINHNE IPKTSSNYKQ DLQMILSCRH ETMNDSSYIG NYCSATERKF  180
HYHPAAFTHN TTLAPVIPNK YHQFYPNTMH QDKNHESVEF YDFLQVNTES NRSEVIDINT  240
RKDEEEVDQL EAIRQQEHTK AAGAPFIDFF SGGSVTS*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A4e-3251066107B-MYB
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00145DAPTransfer from AT1G17950Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004299490.10.0PREDICTED: transcriptional activator Myb
TrEMBLU5FPX41e-102U5FPX4_POPTR; Uncharacterized protein
STRINGPOPTR_0015s05130.11e-102(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF23034243
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G17950.13e-84myb domain protein 52